PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00208.1_g00016.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 455aa    MW: 50765.4 Da    PI: 7.2036
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00208.1_g00016.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding26.21.9e-081359448
                             S-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  4 WTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqkyl 48
                             W+ ++d  + +a + +  +   +W++Ia  ++ g+tl+q++ ++ k+l
  Rsa1.0_00208.1_g00016.1 13 WSRDDDIAFERALAVYTAEidnRWEKIADVVP-GKTLEQVIKHYEKLL 59
                             *****************99*************.***********9986 PP

2Myb_DNA-binding43.86e-14117161347
                              SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              +W++ E+ ++v + k++G+g+W++I+r++ ++Rt+ q+ s+ qky
  Rsa1.0_00208.1_g00016.1 117 PWSPLEHSQFVLGLKKYGKGDWRSISRHVVLTRTPTQVASHAQKY 161
                              7*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512937.941862IPR017884SANT domain
SMARTSM007177.7E-9961IPR001005SANT/Myb domain
SuperFamilySSF466895.6E-111167IPR009057Homeodomain-like
PfamPF002492.0E-61359IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.9E-41361IPR009057Homeodomain-like
CDDcd001675.41E-91359No hitNo description
Gene3DG3DSA:1.10.10.605.1E-9109163IPR009057Homeodomain-like
PROSITE profilePS5129417.266109166IPR017930Myb domain
SuperFamilySSF466893.14E-14112166IPR009057Homeodomain-like
TIGRFAMsTIGR015578.0E-13114164IPR006447Myb domain, plants
SMARTSM007176.1E-10114164IPR001005SANT/Myb domain
PfamPF002496.2E-11117161IPR001005SANT/Myb domain
CDDcd001673.97E-9117162No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 455 aa     Download sequence    Send to blast
MVVGVKTSGG SFWSRDDDIA FERALAVYTA EIDNRWEKIA DVVPGKTLEQ VIKHYEKLLR  60
DVMLIESGSI PFPDYNEVPE ETNVRERCIG ERGIDHKCKY KQEDEPKPKP NRRKAIPWSP  120
LEHSQFVLGL KKYGKGDWRS ISRHVVLTRT PTQVASHAQK YFARLKATNR SRQRHSIHDV  180
NIAESSNISA TEAPVTWQDA QATSKPSFDH HAYETPTIWN TKASSQPSSL DHPTYATPTM  240
WNTQSTSPPS SLDHPTYVTT PTIWNTQATS QPSSLDHPTY ATPTMWNTQS TSPPSSLDHP  300
TYATTPTIWN TQATSQPSSL DHPTYATPTI WNTQSTSSPS SLDHPTYATT PTIWNTQITS  360
PPSVLDHHVF RTPTIWNMQA ASQPPENVPG YGTSSIGQSM VTPYVLPYGA DMNLLAAPYM  420
AYGVQHPSVP HTSVSRAPFN TGLFSDNMTY ISTSR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A1e-141075873RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013619815.11e-140PREDICTED: transcription factor DIVARICATA-like
TrEMBLA0A0D3AXZ81e-140A0A0D3AXZ8_BRAOL; Uncharacterized protein
STRINGBra029380.1-P1e-132(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM133911628
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23650.14e-92Homeodomain-like transcriptional regulator